PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G34240.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 736aa    MW: 81772 Da    PI: 6.2513
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G34240.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.81.4e-24599643145
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                      kpr+rWtpeLHerFv+av++LGGsekAtPk++ ++mkv+gLt++h
  OPUNC02G34240.2 599 KPRMRWTPELHERFVDAVNKLGGSEKATPKAVQKVMKVEGLTIYH 643
                      79*****************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF111071.4E-4510220No hitNo description
PfamPF111074.0E-16228353No hitNo description
SuperFamilySSF466894.3E-10596643IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-21598643IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-16599642IPR006447Myb domain, plants
PfamPF002493.0E-6601641IPR001005SANT/Myb domain
PfamPF143791.0E-17665707IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MGWAHETVAM EELLGLVRGF VDVLVLAGGH TSSGAAATWR SGDVKKALQW ALFFEEVFKN  60
LRDNGQYDGS ARELDAALVQ LTSSPNFPKG IEDIRSKTLS TARYLVVKHF LKTTSVENLG  120
AVLQAVVEMD MDGISASSER NVCQEYVQSI LDTNLPSLMR TKNARDVGHS TSSDEFCEES  180
LFMGNSQILL KELQKNLDSG SCISLAEKGL STLLKSMKKN SFGGAGSTSC TPATAQKAQI  240
VDKFILWKQW RAKCLSYLLD ERTIRIMSGA NLIFNAPKEQ WMGLFEPLKD SSQSGIVEVM  300
ELCLLGLVAR QWNSLIESFM SHTFSSFPIS KQYADLHQLL QGTTQDECQD KLLGFKEMDI  360
CEYATQSLES EPYILWLLPP VLTAAAMPPR SSLFKKYLVE IDKQLSEAAS KDRPTSTMNQ  420
LRNGKVPRYL SPAITVVPAL SEVAFPSFSE HRPSYIEREQ CGSSINSFDA STPMMVYPKV  480
SEQNSWSQEP LPGPFVCPTS VDFFDQQDMA IFDQQIQDNI AASPSTNLAK QNEWFSSGTS  540
LQYLESSVSA GSVLKAVDAT STTPSNYPHC HAQRNTSNPP NFNELCSDNI ASSNIAPTKP  600
RMRWTPELHE RFVDAVNKLG GSEKATPKAV QKVMKVEGLT IYHKYRTVHH RPELSDGRGM  660
ETTCEGLRVQ IGLQKQLHEQ LEIQRKLQLQ VEEHSKYLAM IIAKQSESLR QLGALPRSLD  720
APTQCQKLQA EAVLNC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0663820.0AK066382.1 Oryza sativa Japonica Group cDNA clone:J013064K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627298.10.0PREDICTED: uncharacterized protein LOC4331121 isoform X1
RefseqXP_015627299.10.0PREDICTED: uncharacterized protein LOC4331121 isoform X1
RefseqXP_015627300.10.0PREDICTED: uncharacterized protein LOC4331121 isoform X1
RefseqXP_015627301.10.0PREDICTED: uncharacterized protein LOC4331121 isoform X1
RefseqXP_015627302.10.0PREDICTED: uncharacterized protein LOC4331121 isoform X1
RefseqXP_015627303.10.0PREDICTED: uncharacterized protein LOC4331121 isoform X1
TrEMBLA0A0E0K6S90.0A0A0E0K6S9_ORYPU; Uncharacterized protein
STRINGBGIOSGA005373-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.15e-38phosphate starvation response 1